Sale!

LL-37 5mg

Original price was: $109.00.Current price is: $79.00.

LL-37 is a cationic antimicrobial peptide with broad-spectrum activity, disrupting microbial membranes and modulating immune responses. It interacts with PRRs to regulate inflammation, promote wound healing, and neutralize LPS, with potential applications in antimicrobial resistance and inflammation research.

Buy LL-37 peptide 5 mg Online

Buy LL-37 peptide Online. LL-37 is a cationic, amphipathic antimicrobial peptide derived from the cathelicidin family, with a 37-amino acid sequence encoded by the hCAP18 precursor. It exhibits broad-spectrum antimicrobial activity, including against Gram-positive and Gram-negative bacteria, fungi, and viruses, by disrupting microbial membrane integrity and inducing intracellular perturbations. LL-37 engages immune modulatory pathways through interaction with pattern recognition receptors (PRRs), such as Toll-like receptors (TLRs) and formyl peptide receptor-like 1 (FPRL1), resulting in the regulation of inflammatory cytokine release and chemotaxis in non-human test subjects. Additionally, it enhances angiogenesis and epithelial cell migration, contributing to wound repair processes. The peptide also plays a role in modulating the immune response in animal test subjects by neutralizing lipopolysaccharides (LPS), thus attenuating endotoxin-induced inflammatory pathways.

Research on LL-37 further reveals its bifunctional role in oncological contexts, where it may exert both tumor-suppressive and tumor-promoting effects, contingent upon the surrounding microenvironment. Due to its multifaceted biological activities, LL-37 is of significant interest in preclinical studies aimed at investigating its potential therapeutic applications in combating microbial resistance and modulating inflammatory responses in non-human test subjects.

Discover the Benefits and Uses

LL-37 is a remarkable antimicrobial peptide renowned for its diverse health benefits. Specifically, this peptide plays a crucial role as an immunity booster, enhancing your body’s defense against infections and diseases. Additionally, research studies have shown that LL-37 promotes wound healing, making it a valuable addition to skincare regimens. For those looking to buy LL-37 peptide, you’ll find various affordable LL-37 supplements available online, making it easy to incorporate this powerful compound into your healthcare routine.

Possible Side Effects and Precautions

While there are numerous LL-37 health benefits, it’s important to consider potential side effects. As with any peptide, individual responses can vary; some users may experience mild irritation or allergic reactions. Therefore, it’s advisable to check LL-37 peptide reviews and consult with a healthcare provider before making an LL-37 injection purchase. For those seeking natural LL-37 alternatives, ensure to evaluate your options thoroughly to find the best place to buy LL-37 safely, whether for skincare or immune support.

Summary of Characteristics

Characteristic Details
Chemical Sequence of Amino Acids LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRT
Molecular Formula C205H340N60O53
Molecular Weight 4,493.32 g/mol:
Other Known Titles Cathelicidin, hCAP18, CRAMP (Cationic Antimicrobial Peptide)
Scroll to Top