Buy FOXO4-DRI Peptide: A Tool for Senescence Research
Buy FOXO4-DRI Online. FOXO4-DRI peptide is, in fact, a synthetic research compound specifically designed to disrupt the interaction between FOXO4, a protein involved in the cellular stress response, and p53, a regulator of cell cycle and apoptosis. Consequently, this targeted disruption facilitates the selective removal of senescent cells—non-dividing cells that accumulate in tissues during aging—in laboratory test subjects.
Furthermore, senescent cells are known for releasing inflammatory factors collectively called the senescence-associated secretory phenotype (SASP). As a result, these factors can contribute to cellular dysfunction and tissue degradation. FOXO4-DRI operates by binding to FOXO4 in these aging cells, thereby preventing its interaction with p53. This action, therefore, triggers apoptosis in senescent cells without affecting normal, dividing cells. Thus, it becomes an invaluable tool in studies focused on cellular aging and rejuvenation in laboratory test subjects.
Understanding Its Advantages
Research using non-human models has highlighted FOXO4-DRI’s significant role in improving tissue health and cellular turnover. By clearing senescent cells, it effectively reduces oxidative stress and enhances the overall cellular environment. Consequently, these properties make it a focal point in laboratory studies exploring age-related tissue changes and cellular resilience.
Structurally, FOXO4-DRI is engineered for stability and bioavailability. Importantly, it resists enzymatic degradation, thereby ensuring consistent effects in controlled research environments. Known in scientific circles by other names such as FOXO4-D-Retro-Inverso Peptide, FOXO4-DRI continues to drive breakthroughs in the understanding of senescence. In this way, it provides researchers with a robust tool for probing the molecular mechanisms of aging in non-human test subjects.
What are the benefits of FOXO4?
FOXO4-p53 Disruption: Allows damaged or senescent cells to undergo apoptosis (programmed cell death) Selective Action: Leaves healthy, functioning cells untouched. Systemic Benefits: Improves tissue function, mitochondrial health, and reduces oxidative stress.
Summary of Characteristics
| Characteristic | Details |
|---|---|
| Chemical Sequence of Amino Acids | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP |
| CAS Number | 2460055-10-9 |
| Molecular Formula | C228H388N86O64 |
| Molecular Weight | 5358.05 g/mol |
| Other Known Titles | FOXO4-D-Retro-Inverso Peptide, FOXO4-DRI |
